PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g025760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 348aa    MW: 39149.2 Da    PI: 6.0029
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g025760.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-092783102355
                       SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +yps++++  LA+++gL+++q+ +WF N+R ++
  Sopen02g025760.1 278 PYPSESQKLALAESTGLDQKQINNWFINQRKRH 310
                       8*****************************885 PP

2ELK41.23.5e-14230251122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELK qLlrKYsgyLgsLkqEF+
  Sopen02g025760.1 230 ELKGQLLRKYSGYLGSLKQEFM 251
                       9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-1987131IPR005540KNOX1
PfamPF037902.6E-2289128IPR005540KNOX1
SMARTSM012563.3E-25140191IPR005541KNOX2
PfamPF037914.3E-21144190IPR005541KNOX2
PfamPF037895.7E-11230251IPR005539ELK domain
PROSITE profilePS5121311.174230250IPR005539ELK domain
SMARTSM011882.8E-8230251IPR005539ELK domain
PROSITE profilePS5007112.827250313IPR001356Homeobox domain
SMARTSM003891.3E-11252317IPR001356Homeobox domain
SuperFamilySSF466891.41E-19252327IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-27255315IPR009057Homeodomain-like
CDDcd000865.46E-12262314No hitNo description
PfamPF059201.5E-17270309IPR008422Homeobox KN domain
PROSITE patternPS000270288311IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MEGGSSGNTN TSCLMMMGYG DHENNNGNGN GNGNVTICAP PMMMMMPPPP SLTNNNNAET  60
SNNNILFLPF LDNNNNNNPQ EDNNSSSSIK SKIMAHPHYH RLLTAYLNCQ KIGAPPEVVA  120
RLEEICATSA TMGRSSSSSS GGIIGEDPAL DQFMEAYCEM LIKYEQELSK PFKEAMVFLS  180
RIECQFKALT LAPNSSHESA LGEAMDRNGS SDEEVDVNNS FIDPQAEDRE LKGQLLRKYS  240
GYLGSLKQEF MKKRKKGKLP KEARQQLVDW WLRHIKWPYP SESQKLALAE STGLDQKQIN  300
NWFINQRKRH WKPSEDMQFV VMDAAHPHYY MDNVLANHFP MDMTPSLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1245254LKQEFMKKRK
2251255KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLEAF0001410.0AF000141.1 Lycopersicon esculentum class I knotted-like homeodomain protein (LeT6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015063741.10.0PREDICTED: homeobox protein knotted-1-like LET6 isoform X2
SwissprotO222990.0LET6_SOLLC; Homeobox protein knotted-1-like LET6
TrEMBLK4B9Y20.0K4B9Y2_SOLLC; Uncharacterized protein
STRINGSolyc02g081120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68352433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-128KNOX/ELK homeobox transcription factor